Lineage for d6a1va_ (6a1v A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373886Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2374079Protein automated matches [190029] (5 species)
    not a true protein
  7. 2374087Species Human (Homo sapiens) [TaxId:9606] [186749] (26 PDB entries)
  8. 3061530Domain d6a1va_: 6a1v A: [361592]
    automated match to d1g86a_

Details for d6a1va_

PDB Entry: 6a1v (more details), 1.98 Å

PDB Description: charcot-leyden crystal protein/galectin-10 variant e33q
PDB Compounds: (A:) Galectin-10

SCOPe Domain Sequences for d6a1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a1va_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sllpvpyteaaslstgstvtikgrplacflnqpylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr

SCOPe Domain Coordinates for d6a1va_:

Click to download the PDB-style file with coordinates for d6a1va_.
(The format of our PDB-style files is described here.)

Timeline for d6a1va_:

  • d6a1va_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27