Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) duplication: tandem repeat of two OB-fold domains |
Family b.40.16.0: automated matches [233467] (1 protein) not a true family |
Protein automated matches [233468] (3 species) not a true protein |
Species Mus musculus [TaxId:10092] [361551] (2 PDB entries) |
Domain d5yzwa2: 5yzw A:528-615 [361581] Other proteins in same PDB: d5yzwa3, d5yzwb3 automated match to d3rn2a2 |
PDB Entry: 5yzw (more details), 2 Å
SCOPe Domain Sequences for d5yzwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yzwa2 b.40.16.0 (A:528-615) automated matches {Mus musculus [TaxId: 10092]} pkisylfsqargtfvsgeylvnkkternkfiyygigddtgkmevvvygrltnvrcepgsk lrlvcfeltstedgwqlrsvrhsymqvi
Timeline for d5yzwa2: