Lineage for d5yzwa2 (5yzw A:528-615)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791336Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) (S)
    duplication: tandem repeat of two OB-fold domains
  5. 2791368Family b.40.16.0: automated matches [233467] (1 protein)
    not a true family
  6. 2791369Protein automated matches [233468] (3 species)
    not a true protein
  7. 2791404Species Mus musculus [TaxId:10092] [361551] (2 PDB entries)
  8. 2791408Domain d5yzwa2: 5yzw A:528-615 [361581]
    Other proteins in same PDB: d5yzwa3, d5yzwb3
    automated match to d3rn2a2

Details for d5yzwa2

PDB Entry: 5yzw (more details), 2 Å

PDB Description: crystal structure of p204 hinb domain
PDB Compounds: (A:) Ifi204

SCOPe Domain Sequences for d5yzwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yzwa2 b.40.16.0 (A:528-615) automated matches {Mus musculus [TaxId: 10092]}
pkisylfsqargtfvsgeylvnkkternkfiyygigddtgkmevvvygrltnvrcepgsk
lrlvcfeltstedgwqlrsvrhsymqvi

SCOPe Domain Coordinates for d5yzwa2:

Click to download the PDB-style file with coordinates for d5yzwa2.
(The format of our PDB-style files is described here.)

Timeline for d5yzwa2: