Lineage for d6fpit_ (6fpi T:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019205Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 3019206Protein automated matches [191172] (11 species)
    not a true protein
  7. 3019254Species Escherichia coli [TaxId:83333] [351202] (9 PDB entries)
  8. 3019266Domain d6fpit_: 6fpi T: [361579]
    Other proteins in same PDB: d6fpil_, d6fpim_
    automated match to d3rgws_
    complexed with cl, ej2, f3s, lmt, mg, sf3, sf4, so4

Details for d6fpit_

PDB Entry: 6fpi (more details), 1.5 Å

PDB Description: structure of fully reduced hydrogenase (hyd-1) variant e28q
PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d6fpit_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fpit_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 83333]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrvvdip

SCOPe Domain Coordinates for d6fpit_:

Click to download the PDB-style file with coordinates for d6fpit_.
(The format of our PDB-style files is described here.)

Timeline for d6fpit_: