Lineage for d5zahu_ (5zah U:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2389542Protein automated matches [190044] (14 species)
    not a true protein
  7. 2389583Species Human (Homo sapiens) [TaxId:9606] [187233] (156 PDB entries)
  8. 3061501Domain d5zahu_: 5zah U: [361563]
    automated match to d1kigh_
    complexed with 30i

Details for d5zahu_

PDB Entry: 5zah (more details), 2.98 Å

PDB Description: upa-bb2-30f
PDB Compounds: (U:) urokinase-type plasminogen activator chain b

SCOPe Domain Sequences for d5zahu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zahu_ b.47.1.2 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

SCOPe Domain Coordinates for d5zahu_:

Click to download the PDB-style file with coordinates for d5zahu_.
(The format of our PDB-style files is described here.)

Timeline for d5zahu_:

  • d5zahu_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20