Lineage for d5yzka_ (5yzk A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499110Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 2499111Superfamily d.7.1: LysM domain [54106] (2 families) (S)
    automatically mapped to Pfam PF01476
  5. 2499120Family d.7.1.0: automated matches [234000] (1 protein)
    not a true family
  6. 2499121Protein automated matches [234001] (5 species)
    not a true protein
  7. 2499156Species Volvox carteri [TaxId:3068] [330095] (3 PDB entries)
  8. 3061500Domain d5yzka_: 5yzk A: [361562]
    automated match to d5k2la_

Details for d5yzka_

PDB Entry: 5yzk (more details)

PDB Description: solution structure of lysm domain from a chitinase derived from volvox carteri
PDB Compounds: (A:) Chitinase, lysozyme

SCOPe Domain Sequences for d5yzka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yzka_ d.7.1.0 (A:) automated matches {Volvox carteri [TaxId: 3068]}
mgctytiqpgdtfwaiaqrrgttvdviqslnpgvnparlqvgqvinvpc

SCOPe Domain Coordinates for d5yzka_:

Click to download the PDB-style file with coordinates for d5yzka_.
(The format of our PDB-style files is described here.)

Timeline for d5yzka_:

  • d5yzka_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20