Lineage for d6n1na1 (6n1n A:18-264)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (53 species)
    not a true protein
  7. 3061497Species Sebaldella termitidis [TaxId:526218] [361559] (1 PDB entry)
  8. 3061498Domain d6n1na1: 6n1n A:18-264 [361560]
    Other proteins in same PDB: d6n1na2
    automated match to d4jf5a_
    complexed with gol, so4

Details for d6n1na1

PDB Entry: 6n1n (more details), 1.6 Å

PDB Description: crystal structure of class d beta-lactamase from sebaldella termitidis atcc 33386
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6n1na1:

Sequence, based on SEQRES records: (download)

>d6n1na1 e.3.1.0 (A:18-264) automated matches {Sebaldella termitidis [TaxId: 526218]}
mvsnsnvnlqkifdenkitgsvtiydyknkiwiysneedskirrlpastfkipnslifle
eevvkdeneamewdgikryienwnkdlnlreayeysalwfymkgagkiksekykeylkef
nygnqivsekknsfwidrslkispeeqidflinlyeekfmlsektykivkdiminektpe
ytlrgktgwgregaeniiwyvgyieakenvyffavriinaseernsylldfrkqltmmaf
relgiin

Sequence, based on observed residues (ATOM records): (download)

>d6n1na1 e.3.1.0 (A:18-264) automated matches {Sebaldella termitidis [TaxId: 526218]}
mvsnvnlqkifdenkitgsvtiydyknkiwiysneedskirrlpastfkipnslifleee
vvkdeneamewdgikryienwnkdlnlreayeysalwfymkgagkiksekykeylkefny
gnqivsekknsfwidrslkispeeqidflinlyeekfmlsektykivkdiminektpeyt
lrgktgwgregaeniiwyvgyieakenvyffavriinaseernsylldfrkqltmmafre
lgiin

SCOPe Domain Coordinates for d6n1na1:

Click to download the PDB-style file with coordinates for d6n1na1.
(The format of our PDB-style files is described here.)

Timeline for d6n1na1:

  • d6n1na1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6n1na2