Lineage for d6n1ma1 (6n1m A:1-463)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337218Family a.127.1.1: L-aspartase/fumarase [48558] (6 proteins)
  6. 2337334Protein automated matches [190147] (8 species)
    not a true protein
  7. 3061484Species Legionella pneumophila [TaxId:272624] [361546] (1 PDB entry)
  8. 3061485Domain d6n1ma1: 6n1m A:1-463 [361547]
    Other proteins in same PDB: d6n1ma2
    automated match to d3e04b_
    complexed with edo, so4

Details for d6n1ma1

PDB Entry: 6n1m (more details), 1.55 Å

PDB Description: crystal structure of fumarate hydratase class ii from legionella pneumophila philadelphia 1
PDB Compounds: (A:) fumarate hydratase class II

SCOPe Domain Sequences for d6n1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n1ma1 a.127.1.1 (A:1-463) automated matches {Legionella pneumophila [TaxId: 272624]}
maktrvetdsmgeievpsdkywgaqterslhhfnigkdimprevthafgilkkaaaltnl
elgklpkdkadlivqaaeevskglldehfplhvwqtgsgtqsnmnanevisnraielagg
tlgskspihpndhvnmsqssndtfptamhiaaaiafnekllpavrnlrhvfaakmdafkn
iikigrthlqdavpltlgqefsgyvaqldacvhrleevlpelyelaaggtavgtglnthp
qfavkvaehiakitklpfvtapnkfaalasheplvhahgamktlacalmkiandirwlas
gprcgigeliipenepgssimpgkvnptqceamtmvcaqvlgndtavgiadsqgnfelnv
fkpviifnvlhslnlladschsfqefcaegiepnqpvidyylhhslmlvtalnqhigydk
aakiaktahhdnislqeaavklgiltaeqfaefvkpekmispe

SCOPe Domain Coordinates for d6n1ma1:

Click to download the PDB-style file with coordinates for d6n1ma1.
(The format of our PDB-style files is described here.)

Timeline for d6n1ma1:

  • d6n1ma1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6n1ma2