SCOPe 2.08: Domain d5qija_: 5qij A:

Lineage for d5qija_ (5qij A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141879] (7 PDB entries)
   Uniprot P50172 24-298

8. Domain d5qija_: 5qij A: [361537]
   automated match to d1y5ma1
   complexed with hjg, nap, so4

Details for d5qija_

PDB Entry: 5qij, 2.65 Å

PDB Description: crystal structure of murine 11b- hydroxysteroiddehydrogenase complexed with 2-(3-(1-(4- chlorophenyl)cyclopropyl)-[1,2,4]triazolo[4,3- a]pyridin-8- yl)propan-2-ol

PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d5qija_:

Sequence; same for both SEQRES and ATOM records:

>d5qija_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Mouse (Mus musculus) [TaxId: 10090]}
eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
pillgnpgrkimeffslryynkdmf

Timeline for d5qija_:

• d5qija_ first appeared in SCOPe 2.07