Lineage for d5tx3b1 (5tx3 B:1-334)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (28 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1032 PDB entries)
  8. 3061472Domain d5tx3b1: 5tx3 B:1-334 [361534]
    Other proteins in same PDB: d5tx3a2, d5tx3b2
    automated match to d4ixpa_
    complexed with 7my

Details for d5tx3b1

PDB Entry: 5tx3 (more details), 2.9 Å

PDB Description: structure of maternal embryonic leucine zipper kinase
PDB Compounds: (B:) maternal embryonic leucine zipper kinase

SCOPe Domain Sequences for d5tx3b1:

Sequence, based on SEQRES records: (download)

>d5tx3b1 d.144.1.0 (B:1-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkdydellkyyelhetigtggfakvklachiltgemvaikimdkntlgsdlprikteiea
lknlrhqhicqlyhvletankifmvleycpggelfdyiisqdrlseeetrvvfrqivsav
ayvhsqgyahrdlkpenllfdeyhklklidfglcakpkgnkdyhlqtccgslayaapeli
qgksylgseadvwsmgillyvlmcgflpfdddnvmalykkimrgkydvpkwlspssilll
qqmlqvdpkkrismknllnhpwimqdynypvewqsknpfihldddcvtelsvhhrnnrqt
medlislwqydhltatyllllakkargkpvrlrl

Sequence, based on observed residues (ATOM records): (download)

>d5tx3b1 d.144.1.0 (B:1-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkdydellkyyelhetigkvklachiltgemvaikimdkkteiealknlrhqhicqlyhv
letankifmvleycpggelfdyiisqdrlseeetrvvfrqivsavayvhsqgyahrdlkp
enllfdeyhklklidgslayaapeliqglgseadvwsmgillyvlmcgflpfdddnvmal
ykkimrgkydvpkwlspssilllqqmlqvdpkkrismknllnhpwimqdynypvewqskn
pfihldddcvtelsvhhrnnrqtmedlislwqydhltatyllllakkargkpvrlrl

SCOPe Domain Coordinates for d5tx3b1:

Click to download the PDB-style file with coordinates for d5tx3b1.
(The format of our PDB-style files is described here.)

Timeline for d5tx3b1:

  • d5tx3b1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20

View in 3D
Domains from same chain:
(mouse over for more information)
d5tx3b2