Lineage for d6n1cd_ (6n1c D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790843Protein automated matches [191079] (5 species)
    not a true protein
  7. 2790853Species Legionella pneumophila [TaxId:272624] [361487] (1 PDB entry)
  8. 2790857Domain d6n1cd_: 6n1c D: [361530]
    automated match to d4xela_
    complexed with ala, mpd, mrd, na

Details for d6n1cd_

PDB Entry: 6n1c (more details), 2 Å

PDB Description: crystal structure of inorganic pyrophosphatase from legionella pneumophila philadelphia 1
PDB Compounds: (D:) inorganic pyrophosphatase

SCOPe Domain Sequences for d6n1cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n1cd_ b.40.5.1 (D:) automated matches {Legionella pneumophila [TaxId: 272624]}
iqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfyptnygyipntlse
dgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavpttklskmyqsmqtyq
dipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinrynht

SCOPe Domain Coordinates for d6n1cd_:

Click to download the PDB-style file with coordinates for d6n1cd_.
(The format of our PDB-style files is described here.)

Timeline for d6n1cd_: