Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [191079] (5 species) not a true protein |
Species Legionella pneumophila [TaxId:272624] [361487] (1 PDB entry) |
Domain d6n1cd_: 6n1c D: [361530] automated match to d4xela_ complexed with ala, mpd, mrd, na |
PDB Entry: 6n1c (more details), 2 Å
SCOPe Domain Sequences for d6n1cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n1cd_ b.40.5.1 (D:) automated matches {Legionella pneumophila [TaxId: 272624]} iqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfyptnygyipntlse dgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavpttklskmyqsmqtyq dipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinrynht
Timeline for d6n1cd_: