Lineage for d6n6va_ (6n6v A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (55 species)
    not a true protein
  7. 2569662Species Acinetobacter baumannii [TaxId:470] [194613] (53 PDB entries)
  8. 3061463Domain d6n6va_: 6n6v A: [361525]
    automated match to d4jf5a_
    complexed with ke1; mutant

Details for d6n6va_

PDB Entry: 6n6v (more details), 1.55 Å

PDB Description: oxa-23 mutant f110a/m221a low ph form meropenem complex
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6n6va_:

Sequence, based on SEQRES records: (download)

>d6n6va_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
ivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfkmlnaligle
nqktdineifkwkgekrsatawekdmtlgeamklsavpvyqelarrigldlmqkevkrig
fgnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesngy
kifgktgwaadikpqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkqln
ii

Sequence, based on observed residues (ATOM records): (download)

>d6n6va_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
ivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfkmlnaligle
nqktdineifkkdmtlgeamklsavpvyqelarrigldlmqkevkrigfgnaeigqqvdn
fwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesngykifgktgwaadi
kpqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkqlnii

SCOPe Domain Coordinates for d6n6va_:

Click to download the PDB-style file with coordinates for d6n6va_.
(The format of our PDB-style files is described here.)

Timeline for d6n6va_:

  • d6n6va_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20