SCOPe 2.07: Domain d6grma1: 6grm A:1-227

Lineage for d6grma1 (6grm A:1-227)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (213 PDB entries)
   Uniprot P42212

8. Domain d6grma1: 6grm A:1-227 [361521]
   Other proteins in same PDB: d6grma2
   automated match to d3srya_

Details for d6grma1

PDB Entry: 6grm, 2.3 Å

PDB Description: structure of gfpmut2 crystallized at ph 6 and transferred to ph 9

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d6grma1:

Sequence; same for both SEQRES and ATOM records:

>d6grma1 d.22.1.1 (A:1-227) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaa

Timeline for d6grma1:

• d6grma1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20