Lineage for d6nbkf_ (6nbk F:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2453552Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2453553Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2453554Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2453798Protein automated matches [190112] (5 species)
    not a true protein
  7. 3061435Species Bacillus thuringiensis [TaxId:1431339] [361497] (1 PDB entry)
  8. 3061453Domain d6nbkf_: 6nbk F: [361515]
    automated match to d1ceva_
    complexed with ca, mn

Details for d6nbkf_

PDB Entry: 6nbk (more details), 1.91 Å

PDB Description: crystal structure of arginase from bacillus cereus
PDB Compounds: (F:) arginase

SCOPe Domain Sequences for d6nbkf_:

Sequence, based on SEQRES records: (download)

>d6nbkf_ c.42.1.1 (F:) automated matches {Bacillus thuringiensis [TaxId: 1431339]}
kkeisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicierekeiden
tklrnltqvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwyd
ahgdlnteetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldegek
dfirnegikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpvi
gglsyreshlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk

Sequence, based on observed residues (ATOM records): (download)

>d6nbkf_ c.42.1.1 (F:) automated matches {Bacillus thuringiensis [TaxId: 1431339]}
kkeisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicientklrnlt
qvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwydahgdlnt
eetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldegekdfirneg
ikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpvigglsyre
shlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk

SCOPe Domain Coordinates for d6nbkf_:

Click to download the PDB-style file with coordinates for d6nbkf_.
(The format of our PDB-style files is described here.)

Timeline for d6nbkf_:

  • d6nbkf_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20