Lineage for d6n1ce_ (6n1c E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2384029Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2384030Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2384138Protein automated matches [191079] (4 species)
    not a true protein
  7. 3061425Species Legionella pneumophila [TaxId:272624] [361487] (1 PDB entry)
  8. 3061452Domain d6n1ce_: 6n1c E: [361514]
    automated match to d4xela_
    complexed with ala, mpd, mrd, na

Details for d6n1ce_

PDB Entry: 6n1c (more details), 2 Å

PDB Description: crystal structure of inorganic pyrophosphatase from legionella pneumophila philadelphia 1
PDB Compounds: (E:) inorganic pyrophosphatase

SCOPe Domain Sequences for d6n1ce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n1ce_ b.40.5.1 (E:) automated matches {Legionella pneumophila [TaxId: 272624]}
meiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfyptnygyipntl
sedgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavpttklskmyqsmqt
yqdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinrynhtk

SCOPe Domain Coordinates for d6n1ce_:

Click to download the PDB-style file with coordinates for d6n1ce_.
(The format of our PDB-style files is described here.)

Timeline for d6n1ce_:

  • d6n1ce_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20