Lineage for d6q4sa_ (6q4s A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (41 species)
    not a true protein
  7. 3061449Species Streptomyces chartreusis [TaxId:1079985] [361511] (1 PDB entry)
  8. 3061450Domain d6q4sa_: 6q4s A: [361512]
    automated match to d5dz2a_
    complexed with cl

Details for d6q4sa_

PDB Entry: 6q4s (more details), 1.83 Å

PDB Description: crystal structure of a-eudesmol synthase
PDB Compounds: (A:) pentalenene synthase

SCOPe Domain Sequences for d6q4sa_:

Sequence, based on SEQRES records: (download)

>d6q4sa_ a.128.1.0 (A:) automated matches {Streptomyces chartreusis [TaxId: 1079985]}
dvrfdlpfdtpvsehleyararhlrwvwemrlvrsrdgfeeykswdlpqaaartyphasa
ddmvvlmnwfslaflfddqfdasrpdradriaevarelivtplrpagspprvacpitlaw
aevwkylshgmsltwqtrfaaswgrflvahceevdlaarglegtlgldeyaefrrrtvgi
hhsidagersrgfevpaqamghpvmermrdlaadtigfmndihsferekrrgdghnliav
lrrergcswqqatdeayrmtiacldeylelqervpqmcdelrldeaerdrvrmgveaiqh
wingnyewaltsg

Sequence, based on observed residues (ATOM records): (download)

>d6q4sa_ a.128.1.0 (A:) automated matches {Streptomyces chartreusis [TaxId: 1079985]}
dvrfdlpfdtpvsehleyararhlrwvwemrlvrsrdgfeeykswdlpqaaartyphasa
ddmvvlmnwfslaflfddqfdasrpdradriaevarelivtplrpagspprvacpitlaw
aevwkylshgmsltwqtrfaaswgrflvahceevdlaarglegtlgldeyaefrrrtvgi
hhsidagersrgfevpaqamghpvmermrdlaadtigfmndihsfereghnliavlrrer
gcswqqatdeayrmtiacldeylelqervpqmcdelrldeaerdrvrmgveaiqhwingn
yewaltsg

SCOPe Domain Coordinates for d6q4sa_:

Click to download the PDB-style file with coordinates for d6q4sa_.
(The format of our PDB-style files is described here.)

Timeline for d6q4sa_:

  • d6q4sa_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20