Lineage for d6mxeb1 (6mxe B:155-335)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2567892Fold d.387: STING C-terminal-like [254119] (1 superfamily)
    5 helices and 5 strands in one mixed beta-sheet, one long bent helix
  4. 2567893Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) (S)
    Pfam PF15009, PubMed 22579474
  5. 2567894Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)
  6. 2567895Protein Tyrosinase cofactor MelC1 [254420] (1 species)
  7. 2567896Species Human (Homo sapiens) [TaxId:9606] [254863] (26 PDB entries)
  8. 3061446Domain d6mxeb1: 6mxe B:155-335 [361508]
    Other proteins in same PDB: d6mxea2, d6mxeb2
    automated match to d4f5wa_
    complexed with ca, k5s

Details for d6mxeb1

PDB Entry: 6mxe (more details), 2.47 Å

PDB Description: crystal structure of human sting (g230a, h232r, r293q) in complex with compound 18
PDB Compounds: (B:) Stimulator of interferon genes protein

SCOPe Domain Sequences for d6mxeb1:

Sequence, based on SEQRES records: (download)

>d6mxeb1 d.387.1.1 (B:155-335) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
vahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnlsm
adpnirfldklpqqtadragikdrvysnsiyellengqragtcvleyatplqtlfamsqy
sqagfsredrleqaklfcqtlediladapesqnncrliayqepaddssfslsqevlrhlr
q

Sequence, based on observed residues (ATOM records): (download)

>d6mxeb1 d.387.1.1 (B:155-335) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
vahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnlsm
adpnirfldklpqsnsiyellengqragtcvleyatplqtlfamsqysqagfsredrleq
aklfcqtlediladapesqnncrliayqepaddssfslsqevlrhlrq

SCOPe Domain Coordinates for d6mxeb1:

Click to download the PDB-style file with coordinates for d6mxeb1.
(The format of our PDB-style files is described here.)

Timeline for d6mxeb1:

  • d6mxeb1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6mxeb2