Lineage for d6mwab1 (6mwa B:2001-2239)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577188Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
    Pfam PF08016
  6. 2577201Protein NavAb sodium channel [310744] (1 species)
  7. 2577202Species Arcobacter butzleri [TaxId:367737] [310997] (13 PDB entries)
  8. 3061442Domain d6mwab1: 6mwa B:2001-2239 [361504]
    Other proteins in same PDB: d6mwab2
    automated match to d3rvya_
    complexed with cps, px4, so4

Details for d6mwab1

PDB Entry: 6mwa (more details), 2.4 Å

PDB Description: navab voltage-gated sodium channel, residues 1-239
PDB Compounds: (B:) Ion transport protein

SCOPe Domain Sequences for d6mwab1:

Sequence, based on SEQRES records: (download)

>d6mwab1 f.14.1.2 (B:2001-2239) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaiivdamailnqkeeqhiidevqsh

Sequence, based on observed residues (ATOM records): (download)

>d6mwab1 f.14.1.2 (B:2001-2239) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptseilrvlrvlrlfrlvtavpqmrkivsal
isvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsmgi
vrplmevypyawvffipfifvvtfvminlvvaiivdamailnqkeeqhiidevqsh

SCOPe Domain Coordinates for d6mwab1:

Click to download the PDB-style file with coordinates for d6mwab1.
(The format of our PDB-style files is described here.)

Timeline for d6mwab1:

  • d6mwab1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6mwab2