Lineage for d6n6ta_ (6n6t A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (55 species)
    not a true protein
  7. 2569662Species Acinetobacter baumannii [TaxId:470] [194613] (53 PDB entries)
  8. 3061437Domain d6n6ta_: 6n6t A: [361499]
    automated match to d4k0xa_
    complexed with flc; mutant

Details for d6n6ta_

PDB Entry: 6n6t (more details), 1.25 Å

PDB Description: oxa-23 mutant f110a/m221a low ph form
PDB Compounds: (A:) Beta-lactamase oxa23

SCOPe Domain Sequences for d6n6ta_:

Sequence, based on SEQRES records: (download)

>d6n6ta_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
qivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfkmlnaligl
enqktdineifkwkgekrsatawekdmtlgeamklsavpvyqelarrigldlmqkevkri
gfgnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesng
ykifgktgwaadikpqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkql
nii

Sequence, based on observed residues (ATOM records): (download)

>d6n6ta_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
qivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfkmlnaligl
enqktdineifkwkdmtlgeamklsavpvyqelarrigldlmqkevkrigfgnaeigqqv
dnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesngykifgktgwaa
dikpqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkqlnii

SCOPe Domain Coordinates for d6n6ta_:

Click to download the PDB-style file with coordinates for d6n6ta_.
(The format of our PDB-style files is described here.)

Timeline for d6n6ta_:

  • d6n6ta_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20