Lineage for d6mwdb1 (6mwd B:2001-2238)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577188Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
    Pfam PF08016
  6. 2577201Protein NavAb sodium channel [310744] (1 species)
  7. 2577202Species Arcobacter butzleri [TaxId:367737] [310997] (13 PDB entries)
  8. 3061413Domain d6mwdb1: 6mwd B:2001-2238 [361475]
    Other proteins in same PDB: d6mwdb2
    automated match to d3rvya_
    complexed with act, cps, px4, so4; mutant

Details for d6mwdb1

PDB Entry: 6mwd (more details), 2.33 Å

PDB Description: navab voltage-gated sodium channel, residues 1-239 with mutation t206s
PDB Compounds: (B:) Ion transport protein

SCOPe Domain Sequences for d6mwdb1:

Sequence, based on SEQRES records: (download)

>d6mwdb1 f.14.1.2 (B:2001-2238) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvsfvminlvvaiivdamailnqkeeqhiidevqs

Sequence, based on observed residues (ATOM records): (download)

>d6mwdb1 f.14.1.2 (B:2001-2238) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvpteilrvlrvlrlfrlvtavpqmrkivsali
svipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsmgiv
rplmevypyawvffipfifvvsfvminlvvaiivdamailnqkeeqhiidevqs

SCOPe Domain Coordinates for d6mwdb1:

Click to download the PDB-style file with coordinates for d6mwdb1.
(The format of our PDB-style files is described here.)

Timeline for d6mwdb1:

  • d6mwdb1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6mwdb2