Lineage for d6h6ye1 (6h6y E:6-118)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2348290Species Vicugna pacos [TaxId:30538] [189756] (48 PDB entries)
  8. 3061411Domain d6h6ye1: 6h6y E:6-118 [361473]
    Other proteins in same PDB: d6h6ye2, d6h6yf2, d6h6yg2, d6h6yh2
    automated match to d1mqkh_
    complexed with cl, edo, na

Details for d6h6ye1

PDB Entry: 6h6y (more details), 1.58 Å

PDB Description: gi.1 human norovirus protruding domain in complex with nano-7
PDB Compounds: (E:) Nanobody (VHH) Nano-7

SCOPe Domain Sequences for d6h6ye1:

Sequence, based on SEQRES records: (download)

>d6h6ye1 b.1.1.1 (E:6-118) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqaggslrlscavsgrtfsnyysgwfrqapgkereflasirwsdsttnyadsvk
grftisrdtakntvylqmnslkledtavyhcaarrlatydywgqgtqvtvssg

Sequence, based on observed residues (ATOM records): (download)

>d6h6ye1 b.1.1.1 (E:6-118) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqaggslrlscavsgrtfsnyysgwfrqapkereflasirwsdsttnyadsvkg
rftisrdtakntvylqmnslkledtavyhcaarrlatydywgqgtqvtvssg

SCOPe Domain Coordinates for d6h6ye1:

Click to download the PDB-style file with coordinates for d6h6ye1.
(The format of our PDB-style files is described here.)

Timeline for d6h6ye1:

  • d6h6ye1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20