Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.0: automated matches [191588] (1 protein) not a true family |
Protein automated matches [191059] (15 species) not a true protein |
Species Croceicoccus marinus [TaxId:450378] [361450] (6 PDB entries) |
Domain d6iq7b_: 6iq7 B: [361471] automated match to d3hp4a_ complexed with 2mz, act, ca, edo |
PDB Entry: 6iq7 (more details), 1.9 Å
SCOPe Domain Sequences for d6iq7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iq7b_ c.23.10.0 (B:) automated matches {Croceicoccus marinus [TaxId: 450378]} davmptgpaidvlafgdslfagyrldrdesyparlqaalrerglnvnvtnagvsgdttaa glqridfvldsmagepdlvllelgandmlrglpaeearrnldtilqrldqrdipvmvygm raapnlggdygrsfdsifpdladkydaelvpffieplifdrslvqqdqlhptaqgvdamv eqtveqvedriddl
Timeline for d6iq7b_: