Lineage for d6h38a_ (6h38 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2401369Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2402230Protein automated matches [190681] (2 species)
    not a true protein
  7. 2402240Species Human (Homo sapiens) [TaxId:9606] [187805] (41 PDB entries)
  8. 3061408Domain d6h38a_: 6h38 A: [361470]
    automated match to d3ml5a_
    complexed with fkk, gol, zn

Details for d6h38a_

PDB Entry: 6h38 (more details), 1.7 Å

PDB Description: the crystal structure of human carbonic anhydrase vii in complex with 4-[(4-fluorophenyl)methyl]-1-piperazinyl]benzenesulfonamide.
PDB Compounds: (A:) Carbonic anhydrase 7

SCOPe Domain Sequences for d6h38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h38a_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwgygqddgpshwhklypiaqgdrqspiniissqavyspslqplelsyeacmslsitnng
hsvqvdfndsddrtvvtggplegpyrlkqfhfhwgkkhdvgsehtvdgksfpselhlvhw
nakkystfgeaasapdglavvgvfletgdehpsmnrltdalymvrfkgtkaqfscfnpks
llpasrhywtypgslttpplsesvtwivlrepisiserqmgkfrsllftsedderihmvn
nfrppqplkgrvvkasfra

SCOPe Domain Coordinates for d6h38a_:

Click to download the PDB-style file with coordinates for d6h38a_.
(The format of our PDB-style files is described here.)

Timeline for d6h38a_:

  • d6h38a_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20