Lineage for d6iq8b_ (6iq8 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440037Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2440158Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2440159Protein automated matches [191059] (14 species)
    not a true protein
  7. 3061388Species Croceicoccus marinus [TaxId:450378] [361450] (2 PDB entries)
  8. 3061401Domain d6iq8b_: 6iq8 B: [361463]
    automated match to d3hp4a_
    complexed with act, ca, edo; mutant

Details for d6iq8b_

PDB Entry: 6iq8 (more details), 2.24 Å

PDB Description: esterase crme10 mutant-d178a
PDB Compounds: (B:) carboxylesterase

SCOPe Domain Sequences for d6iq8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iq8b_ c.23.10.0 (B:) automated matches {Croceicoccus marinus [TaxId: 450378]}
gpaidvlafgdslfagyrldrdesyparlqaalrerglnvnvtnagvsgdttaaglqrid
fvldsmagepdlvllelgandmlrglpaeearrnldtilqrldqrdipvmvygmraapnl
ggdygrsfdsifpdladkydaelvpffieplifdrslvqqaqlhptaqgvdamveqtveq
vedriddl

SCOPe Domain Coordinates for d6iq8b_:

Click to download the PDB-style file with coordinates for d6iq8b_.
(The format of our PDB-style files is described here.)

Timeline for d6iq8b_:

  • d6iq8b_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20