Lineage for d6dmka_ (6dmk A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316814Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2316891Protein automated matches [190366] (2 species)
    not a true protein
  7. 2316892Species Human (Homo sapiens) [TaxId:9606] [187201] (53 PDB entries)
  8. 3061398Domain d6dmka_: 6dmk A: [361460]
    automated match to d4nyxa_
    complexed with 2ll, edo, no3

Details for d6dmka_

PDB Entry: 6dmk (more details), 1.66 Å

PDB Description: a multiconformer ligand model of an isoxazolyl-benzimidazole ligand bound to the bromodomain of human crebbp
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d6dmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dmka_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqs

SCOPe Domain Coordinates for d6dmka_:

Click to download the PDB-style file with coordinates for d6dmka_.
(The format of our PDB-style files is described here.)

Timeline for d6dmka_:

  • d6dmka_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20