Lineage for d6f6oa_ (6f6o A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2371823Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2371824Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2371825Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2371826Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2371883Species Human adenovirus b serotype 3 [TaxId:45659] [274530] (2 PDB entries)
  8. 3061396Domain d6f6oa_: 6f6o A: [361458]
    automated match to d3cnca_
    mutant

Details for d6f6oa_

PDB Entry: 6f6o (more details), 1.49 Å

PDB Description: structure of adenovirus 3 fiber head v239d mutant
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d6f6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f6oa_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus b serotype 3 [TaxId: 45659]}
nntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknknv
sinvelyfdatghilpdssslktdlelkykqtadfsargfmpsttaypfdlpnagthnen
yifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitsp
ftfsyiredd

SCOPe Domain Coordinates for d6f6oa_:

Click to download the PDB-style file with coordinates for d6f6oa_.
(The format of our PDB-style files is described here.)

Timeline for d6f6oa_:

  • d6f6oa_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20