Lineage for d6i55a_ (6i55 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2414850Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2414895Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2414968Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141759] (3 PDB entries)
    Uniprot Q08210 158-566
    homolog, mitochonrial
  8. 3061395Domain d6i55a_: 6i55 A: [361457]
    automated match to d1tv5a1
    complexed with dzb, fmn, oro

Details for d6i55a_

PDB Entry: 6i55 (more details), 1.98 Å

PDB Description: plasmodium falciparum dihydroorotate dehydrogenase (dhodh) co- crystallized with n-(2,2-diphenylethyl)-4-hydroxy-1,2,5-thiadiazole- 3-carboxamide
PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d6i55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i55a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
esynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfi
npfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgf
nnmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryady
iainvsspntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfv
klapdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkf
icemynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnh
llyqrgyynlkeaigrkhs

SCOPe Domain Coordinates for d6i55a_:

Click to download the PDB-style file with coordinates for d6i55a_.
(The format of our PDB-style files is described here.)

Timeline for d6i55a_:

  • d6i55a_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20