Lineage for d6ibea3 (6ibe A:297-390)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395025Species Human (Homo sapiens) [TaxId:9606] [186914] (62 PDB entries)
  8. 3061382Domain d6ibea3: 6ibe A:297-390 [361444]
    Other proteins in same PDB: d6ibea1, d6ibea2
    automated match to d2he7a3
    complexed with edo, mes

Details for d6ibea3

PDB Entry: 6ibe (more details), 1.45 Å

PDB Description: the ferm domain of human epb41l3
PDB Compounds: (A:) Band 4.1-like protein 3

SCOPe Domain Sequences for d6ibea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ibea3 b.55.1.0 (A:297-390) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnnfyikirpgef
eqfestigfklpnhraakrlwkvcvehhtffrll

SCOPe Domain Coordinates for d6ibea3:

Click to download the PDB-style file with coordinates for d6ibea3.
(The format of our PDB-style files is described here.)

Timeline for d6ibea3:

  • d6ibea3 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20