Lineage for d6ibea2 (6ibe A:191-296)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309710Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309753Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2309829Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2309830Protein automated matches [254423] (4 species)
    not a true protein
  7. 2309834Species Human (Homo sapiens) [TaxId:9606] [255207] (9 PDB entries)
  8. 3061381Domain d6ibea2: 6ibe A:191-296 [361443]
    Other proteins in same PDB: d6ibea1, d6ibea3
    automated match to d2he7a2
    complexed with edo, mes

Details for d6ibea2

PDB Entry: 6ibe (more details), 1.45 Å

PDB Description: the ferm domain of human epb41l3
PDB Compounds: (A:) Band 4.1-like protein 3

SCOPe Domain Sequences for d6ibea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ibea2 a.11.2.0 (A:191-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdpaqlseditryylclqlrddivsgrlpcsfvtlallgsytvqselgdydpdecgsdyi
sefrfapnhtkeledkvielhkshrgmtpaeaemhflenakklsmy

SCOPe Domain Coordinates for d6ibea2:

Click to download the PDB-style file with coordinates for d6ibea2.
(The format of our PDB-style files is described here.)

Timeline for d6ibea2:

  • d6ibea2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20