Lineage for d6ibea1 (6ibe A:107-190)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (82 PDB entries)
  8. 3061380Domain d6ibea1: 6ibe A:107-190 [361442]
    Other proteins in same PDB: d6ibea2, d6ibea3
    automated match to d2he7a1
    complexed with edo, mes

Details for d6ibea1

PDB Entry: 6ibe (more details), 1.45 Å

PDB Description: the ferm domain of human epb41l3
PDB Compounds: (A:) Band 4.1-like protein 3

SCOPe Domain Sequences for d6ibea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ibea1 d.15.1.0 (A:107-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pksmqckvilldgseytcdvekrsrgqvlfdkvcehlnllekdyfgltyrdaenqknwld
pakeikkqvrsgawhfsfnvkfyp

SCOPe Domain Coordinates for d6ibea1:

Click to download the PDB-style file with coordinates for d6ibea1.
(The format of our PDB-style files is described here.)

Timeline for d6ibea1:

  • d6ibea1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20