![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (20 species) not a true protein |
![]() | Species Vicugna pacos [TaxId:30538] [189756] (47 PDB entries) |
![]() | Domain d6h6yg1: 6h6y G:6-116 [361438] Other proteins in same PDB: d6h6ye2, d6h6yf2, d6h6yg2, d6h6yh2 automated match to d1mqkh_ complexed with cl, edo, na |
PDB Entry: 6h6y (more details), 1.58 Å
SCOPe Domain Sequences for d6h6yg1:
Sequence, based on SEQRES records: (download)
>d6h6yg1 b.1.1.1 (G:6-116) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqaggslrlscavsgrtfsnyysgwfrqapgkereflasirwsdsttnyadsvk grftisrdtakntvylqmnslkledtavyhcaarrlatydywgqgtqvtvs
>d6h6yg1 b.1.1.1 (G:6-116) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqaggslrlscavsgrtfsnyysgwfrqapkereflasirwsdsttnyadsvkg rftisrdtakntvylqmnslkledtavyhcaarrlatydywgqgtqvtvs
Timeline for d6h6yg1: