Lineage for d6gera_ (6ger A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2416559Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2417057Protein automated matches [190099] (28 species)
    not a true protein
  7. 3061368Species Triticum aestivum [TaxId:4565] [361430] (1 PDB entry)
  8. 3061369Domain d6gera_: 6ger A: [361431]
    automated match to d1b1ya_

Details for d6gera_

PDB Entry: 6ger (more details), 2 Å

PDB Description: wheat b-amylase, a clinically relevant food allergen
PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d6gera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gera_ c.1.8.1 (A:) automated matches {Triticum aestivum [TaxId: 4565]}
gnmlanyvqvyvmlpldvvsvdnkfekgdeiraqlkklteagvdgvmidvwwglvegkgp
kaydwsaykqvfdlvheaglklqaimsfhqcggnvgdvvnipipqwvrdvgatdpdifyt
nrggtrnieyltlgvddqplfhgrtavqmyadymasfrenmkkfldagtivdievglgpa
gemrypsypqsqgwvfpgigeficydkyleadfkaaaakaghpewelpddageyndtpek
tqffkdngtyltekgkfflswysnklikhgdkildeankvflgcrvqlaikisgihwwyr
vpnhaaeltagyynlddrdgyrtiarmltrhhasmnftcaemrdseqseeaksapeelvq
qvlsagwreglhvacenalgrydatayntilrnarpkginkngppehklfgftylrlsne
llegqnyatfqtfvekmhanlghdpsvdpvaplerskpempiemilkaaqpklepfpfdk
ntdlpvkd

SCOPe Domain Coordinates for d6gera_:

Click to download the PDB-style file with coordinates for d6gera_.
(The format of our PDB-style files is described here.)

Timeline for d6gera_:

  • d6gera_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20