SCOPe 2.08: Domain d6dz8b1: 6dz8 B:25-315

Lineage for d6dz8b1 (6dz8 B:25-315)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [352201] (11 PDB entries)

8. Domain d6dz8b1: 6dz8 B:25-315 [361425]
   Other proteins in same PDB: d6dz8a2, d6dz8b2
   automated match to d3huna1
   complexed with zn; mutant

Details for d6dz8b1

PDB Entry: 6dz8, 1.86 Å

PDB Description: crystal structure of s. aureus penicillin binding protein 4 (pbp4) mutant (s75c)

PDB Compounds: (B:) Penicillin-binding protein 4

SCOPe Domain Sequences for d6dz8b1:

Sequence; same for both SEQRES and ATOM records:

>d6dz8b1 e.3.1.1 (B:25-315) automated matches {Staphylococcus aureus [TaxId: 93062]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpacmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

Timeline for d6dz8b1:

• d6dz8b1 first appeared in SCOPe 2.07