Lineage for d6h6zc1 (6h6z C:6-126)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2358938Species Vicugna pacos [TaxId:30538] [276396] (11 PDB entries)
  8. 3061361Domain d6h6zc1: 6h6z C:6-126 [361423]
    Other proteins in same PDB: d6h6zc2, d6h6zd2
    automated match to d1mqkh_
    complexed with edo, na

Details for d6h6zc1

PDB Entry: 6h6z (more details), 2.09 Å

PDB Description: gi.1 human norovirus protruding domain in complex with nano-62
PDB Compounds: (C:) Nanobody (VHH) Nano-62

SCOPe Domain Sequences for d6h6zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h6zc1 b.1.1.0 (C:6-126) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvmtggslrlscavsgrtidvsvmawfrqapgkerefvsgmrwsgmttysadsvk
drftisrdktkntvylqmnslkpedtavyycaarsrfivgvpqardlydywgqgtqvtvs
s

SCOPe Domain Coordinates for d6h6zc1:

Click to download the PDB-style file with coordinates for d6h6zc1.
(The format of our PDB-style files is described here.)

Timeline for d6h6zc1:

  • d6h6zc1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6h6zc2