SCOPe 2.07: Domain d6f7ca2: 6f7c A:246-436

Lineage for d6f7ca2 (6f7c A:246-436)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (65 PDB entries)

8. Domain d6f7ca2: 6f7c A:246-436 [361413]
   Other proteins in same PDB: d6f7ca1, d6f7cb1, d6f7cc1, d6f7cd1, d6f7ce_, d6f7cf1, d6f7cf2
   automated match to d4i50a2
   complexed with acp, ca, cvt, gdp, gtp, mes, mg

Details for d6f7ca2

PDB Entry: 6f7c, 2 Å

PDB Description: tubulin-compound 12 complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6f7ca2:

Sequence, based on SEQRES records:

>d6f7ca2 d.79.2.1 (A:246-436) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevg

Sequence, based on observed residues (ATOM records):

>d6f7ca2 d.79.2.1 (A:246-436) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaeqlsvaeitnacfepanqmvkcdprhg
kymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggdlak
vqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalek
dyeevg

Timeline for d6f7ca2:

• d6f7ca2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20