Lineage for d6f7gc_ (6f7g C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308123Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2308124Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 2308163Protein automated matches [254650] (2 species)
    not a true protein
  7. 2308167Species Escherichia coli [TaxId:83334] [340663] (2 PDB entries)
  8. 3061338Domain d6f7gc_: 6f7g C: [361400]
    automated match to d5tm0a_
    complexed with cvw

Details for d6f7gc_

PDB Entry: 6f7g (more details), 1.66 Å

PDB Description: tryptophan repressor trpr from e.coli with 5-methyltryptamine
PDB Compounds: (C:) trp operon repressor

SCOPe Domain Sequences for d6f7gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f7gc_ a.4.12.1 (C:) automated matches {Escherichia coli [TaxId: 83334]}
aamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrgemsq
relknelgagiatitrgsnslkaapvelrqwleevllk

SCOPe Domain Coordinates for d6f7gc_:

Click to download the PDB-style file with coordinates for d6f7gc_.
(The format of our PDB-style files is described here.)

Timeline for d6f7gc_:

  • d6f7gc_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20