Lineage for d6cqfa_ (6cqf A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1053 PDB entries)
  8. 3061335Domain d6cqfa_: 6cqf A: [361397]
    automated match to d4u3yb_
    complexed with f97

Details for d6cqfa_

PDB Entry: 6cqf (more details), 2.25 Å

PDB Description: crystal structure of hpk1 in complex an inhibitor g1858
PDB Compounds: (A:) mitogen-activated protein kinase kinase kinase kinase 1

SCOPe Domain Sequences for d6cqfa_:

Sequence, based on SEQRES records: (download)

>d6cqfa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdifnrdprdhydllqrlgggtygevfkardkvsgdlvalkmvkmepdddvstlqkeili
lktcrhanivayhgsylwlqklwicmefcgagslqdiyqvtgslselqisyvcrevlqgl
aylhsqkkihrdikganilindagevrladfgisaqigatlarrlafigtpywmapevaa
valkggynelcdiwslgitaielaelqpplfdvhplrvlflmtksgyqpprlkekgkwsa
afhnfikvtltkspkkrpsatkmlshqlvsqpglnrglildlldklkn

Sequence, based on observed residues (ATOM records): (download)

>d6cqfa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdifnrdprdhydllqrlgggtygevfkardkvsgdlvalkmvkmepdddvstlqkeili
lktcrhanivayhgsylwlqklwicmefcgagslqdiyqvtgslselqisyvcrevlqgl
aylhsqkkihrdikganilindagevrladfgisaqirlafigtpywmapevaavalkgg
ynelcdiwslgitaielaelqpplfdvhplrvlflmtksgyqpprlkekgkwsaafhnfi
kvtltkspkkrpsatkmlshqlvsqpglnrglildlldklkn

SCOPe Domain Coordinates for d6cqfa_:

Click to download the PDB-style file with coordinates for d6cqfa_.
(The format of our PDB-style files is described here.)

Timeline for d6cqfa_:

  • d6cqfa_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20