SCOPe 2.08: Domain d6f7ga_: 6f7g A:

Lineage for d6f7ga_ (6f7g A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein automated matches [254650] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255682] (2 PDB entries)

8. Domain d6f7ga_: 6f7g A: [361388]
   automated match to d5tm0a_
   complexed with cvw

Details for d6f7ga_

PDB Entry: 6f7g, 1.66 Å

PDB Description: tryptophan repressor trpr from e.coli with 5-methyltryptamine

PDB Compounds: (A:) trp operon repressor

SCOPe Domain Sequences for d6f7ga_:

Sequence; same for both SEQRES and ATOM records:

>d6f7ga_ a.4.12.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknelgagiatitrgsnslkaapvelrqwleevllk

Timeline for d6f7ga_:

• d6f7ga_ first appeared in SCOPe 2.07