Lineage for d6dmia_ (6dmi A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2392520Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2392521Species Human (Homo sapiens) [TaxId:9606] [50672] (288 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 3061322Domain d6dmia_: 6dmi A: [361384]
    automated match to d1fkna_
    complexed with 5t5, dms, na

Details for d6dmia_

PDB Entry: 6dmi (more details), 1.9 Å

PDB Description: a multiconformer ligand model of 5t5 bound to bace-1
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d6dmia_:

Sequence, based on SEQRES records: (download)

>d6dmia_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
rgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrq
lsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnw
egilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmi
iggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlr
lpkkvfeaavasikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqs
fritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfa
vsachvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d6dmia_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
rgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrq
lsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnw
egilglayaeiarpddslepffdslvkqthvpnlfslqlcgasvggsmiiggidhslytg
slwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaava
sikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqyl
rpvsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaave
gpfvtldmedcgyn

SCOPe Domain Coordinates for d6dmia_:

Click to download the PDB-style file with coordinates for d6dmia_.
(The format of our PDB-style files is described here.)

Timeline for d6dmia_:

  • d6dmia_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20