Lineage for d6dz8a2 (6dz8 A:316-383)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409301Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2409302Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 2409332Family b.105.1.0: automated matches [231757] (1 protein)
    not a true family
  6. 2409333Protein automated matches [231758] (5 species)
    not a true protein
  7. 3052142Species Staphylococcus aureus [TaxId:93062] [352204] (7 PDB entries)
  8. 3061316Domain d6dz8a2: 6dz8 A:316-383 [361378]
    Other proteins in same PDB: d6dz8a1, d6dz8b1
    automated match to d3huma2
    complexed with zn; mutant

Details for d6dz8a2

PDB Entry: 6dz8 (more details), 1.86 Å

PDB Description: crystal structure of s. aureus penicillin binding protein 4 (pbp4) mutant (s75c)
PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d6dz8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dz8a2 b.105.1.0 (A:316-383) automated matches {Staphylococcus aureus [TaxId: 93062]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

SCOPe Domain Coordinates for d6dz8a2:

Click to download the PDB-style file with coordinates for d6dz8a2.
(The format of our PDB-style files is described here.)

Timeline for d6dz8a2:

  • d6dz8a2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6dz8a1