SCOPe 2.07: Domain d6btjb1: 6btj B:1-106

Lineage for d6btjb1 (6btj B:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1170 PDB entries)

8. Domain d6btjb1: 6btj B:1-106 [361370]
   Other proteins in same PDB: d6btjb2, d6btjl2
   automated match to d1dn0a1

Details for d6btjb1

PDB Entry: 6btj, 2 Å

PDB Description: crystal structure of pan-h7, anti-hemagglutinin monoclonal antibody h7.5 (fab fragment)

PDB Compounds: (B:) Light chain of H7.5 Fab

SCOPe Domain Sequences for d6btjb1:

Sequence; same for both SEQRES and ATOM records:

>d6btjb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqspsslsasvgdrvtitcrpsqsistflnwyeqkpgkapklliydasslqsgvps
rfsgsgsgteftltisslqpedfatyycqqsfstpytfgqgtrlei

Timeline for d6btjb1:

• d6btjb1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20