SCOPe 2.08: Domain d6bvea_: 6bve A:

Lineage for d6bvea_ (6bve A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (25 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [361356] (1 PDB entry)

8. Domain d6bvea_: 6bve A: [361369]
   automated match to d4y9ab_
   complexed with na, pga

Details for d6bvea_

PDB Entry: 6bve, 1.78 Å

PDB Description: triosephosphate isomerase of synechocystis in complex with 2- phosphoglycolic acid

PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d6bvea_:

Sequence; same for both SEQRES and ATOM records:

>d6bvea_ c.1.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mrkiiiagnwkmhktqaeaqaflqgfkpliedaaesrevvlcvpftdlsgmsqqlhggrv
rlgaqnvhweasgaytgeisaamlteigihyvvighserrqyfgetdetanlrvlaaqka
glipilcvgeskaqrdageteqvivdqvkkglvnvdqsnlviayepiwaigtgdtcaate
anrviglireqltnsqvtiqyggsvnannvdeimaqpeidgalvggaslepqsfarivnf
qp

Timeline for d6bvea_:

• d6bvea_ first appeared in SCOPe 2.07