Lineage for d6b11b_ (6b11 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (79 species)
    not a true protein
  7. 3061286Species Streptomyces fradiae [TaxId:1906] [361348] (1 PDB entry)
  8. 3061287Domain d6b11b_: 6b11 B: [361349]
    automated match to d4ubsa_
    complexed with cgm, edo, hem

Details for d6b11b_

PDB Entry: 6b11 (more details), 1.99 Å

PDB Description: tylhi in complex with native substrate 23-deoxy-5-o-mycaminosyl- tylonolide (23-dmtl)
PDB Compounds: (B:) 20-oxo-5-O-mycaminosyltylactone 23-monooxygenase

SCOPe Domain Sequences for d6b11b_:

Sequence, based on SEQRES records: (download)

>d6b11b_ a.104.1.0 (B:) automated matches {Streptomyces fradiae [TaxId: 1906]}
siawpvartcpfsppeqyaalraeepiaraelwdgapvwlisrqdhvralladprvsihp
aklprlspsdgeaeasrslltldppdhgalrghfipefglrrvrelrpsveqivtglldd
ltargdeadlladfalpmatqvicrlldipyedrdyfqerteqatrpaageealeallel
rdyldrlisgktgresgdgmlgsmvaqarggglshadvldnavlllaaghettasmvtms
vlvllqhptawreltvnpgllpgavdellrylsiadglrrsatadieidghtiragdglv
fllaaanrdeavfsepeafdihrsarrhvafgygphqclgqnlarmelevalgavlerlp
alrpttdvaglrlksdsavfgvyelpvaw

Sequence, based on observed residues (ATOM records): (download)

>d6b11b_ a.104.1.0 (B:) automated matches {Streptomyces fradiae [TaxId: 1906]}
siawpvartcpfsppeqyaalraeepiaraelwdgapvwlisrqdhvralladprvsihp
aklprlspsdgeaeasrslltldppdhgalrghfipefglrrvrelrpsveqivtglldd
ltargdeadlladfalpmatqvicrlldipyedrdyfqerteqatrpaageealeallel
rdyldrlisgkdgmlgsmvaqarggglshadvldnavlllaaghettasmvtmsvlvllq
hptawreltvnpgllpgavdellrylsiadglrrsatadieidghtiragdglvfllaaa
nrdeavfsepeafdihrsarrhvafgygphqclgqnlarmelevalgavlerlpalrptt
dvaglrlksdsavfgvyelpvaw

SCOPe Domain Coordinates for d6b11b_:

Click to download the PDB-style file with coordinates for d6b11b_.
(The format of our PDB-style files is described here.)

Timeline for d6b11b_:

  • d6b11b_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20