Lineage for d6acsa_ (6acs A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490427Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2490428Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2490494Family c.101.1.0: automated matches [191361] (1 protein)
    not a true family
  6. 2490495Protein automated matches [190431] (9 species)
    not a true protein
  7. 3061279Species Acinetobacter baumannii [TaxId:470] [361341] (1 PDB entry)
  8. 3061280Domain d6acsa_: 6acs A: [361342]
    Other proteins in same PDB: d6acsb2
    automated match to d5hxpa_
    complexed with cit, gol, ipa

Details for d6acsa_

PDB Entry: 6acs (more details), 1.81 Å

PDB Description: poly-cis-prenyltransferase
PDB Compounds: (A:) Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

SCOPe Domain Sequences for d6acsa_:

Sequence, based on SEQRES records: (download)

>d6acsa_ c.101.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dseeyhlpqhvaiimdgnnrfakknqmqkgdghregknvldpivehcvktgvraltvfaf
ssenwnrpqyevdllmklleetiheqiprmkkfnialrfigdrsrlpshlvalmedaeqq
tahheamtltiavsyggmwdianaakqvaqavsrgeidadqinvdlfakyvslndlpavd
llirtggdfrisnfllwqaayaelyftdtlwpeftveefdhalnvfsgrerrfgktse

Sequence, based on observed residues (ATOM records): (download)

>d6acsa_ c.101.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dseeyhlpqhvaiimdgnnrfakknvldpivehcvktgvraltvfafssenwnrpqyevd
llmklleetiheqiprmkkfnialrfigdrsrlpshlvalmedaeqqtahheamtltiav
syggmwdianaakqvaqavsrgeidadqinvdlfakyvslndlpavdllirtggdfrisn
fllwqaayaelyftdtlwpeftveefdhalnvfsgrerrfgktse

SCOPe Domain Coordinates for d6acsa_:

Click to download the PDB-style file with coordinates for d6acsa_.
(The format of our PDB-style files is described here.)

Timeline for d6acsa_:

  • d6acsa_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-20