SCOPe 2.08: Domain d6acsa_: 6acs A:

Lineage for d6acsa_ (6acs A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (13 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [361341] (3 PDB entries)

8. Domain d6acsa_: 6acs A: [361342]
   Other proteins in same PDB: d6acsb2
   automated match to d5hxpa_
   complexed with cit, gol, ipa

Details for d6acsa_

PDB Entry: 6acs, 1.81 Å

PDB Description: poly-cis-prenyltransferase

PDB Compounds: (A:) Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

SCOPe Domain Sequences for d6acsa_:

Sequence, based on SEQRES records:

>d6acsa_ c.101.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dseeyhlpqhvaiimdgnnrfakknqmqkgdghregknvldpivehcvktgvraltvfaf
ssenwnrpqyevdllmklleetiheqiprmkkfnialrfigdrsrlpshlvalmedaeqq
tahheamtltiavsyggmwdianaakqvaqavsrgeidadqinvdlfakyvslndlpavd
llirtggdfrisnfllwqaayaelyftdtlwpeftveefdhalnvfsgrerrfgktse

Sequence, based on observed residues (ATOM records):

>d6acsa_ c.101.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dseeyhlpqhvaiimdgnnrfakknvldpivehcvktgvraltvfafssenwnrpqyevd
llmklleetiheqiprmkkfnialrfigdrsrlpshlvalmedaeqqtahheamtltiav
syggmwdianaakqvaqavsrgeidadqinvdlfakyvslndlpavdllirtggdfrisn
fllwqaayaelyftdtlwpeftveefdhalnvfsgrerrfgktse

Timeline for d6acsa_:

• d6acsa_ first appeared in SCOPe 2.07