Lineage for d6a8ia1 (6a8i A:2-313)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397987Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2397997Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2397998Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2398050Protein automated matches [191033] (3 species)
    not a true protein
  7. 3061275Species Geobacillus thermodenitrificans [TaxId:33940] [361337] (2 PDB entries)
  8. 3061277Domain d6a8ia1: 6a8i A:2-313 [361339]
    Other proteins in same PDB: d6a8ia2, d6a8ib2
    automated match to d1wl7a1
    complexed with ahr, ca; mutant

Details for d6a8ia1

PDB Entry: 6a8i (more details), 1.9 Å

PDB Description: crystal structure of endo-arabinanase abn-ts d147n mutant in complex with arabinohexaose
PDB Compounds: (A:) Endo-alpha-(1->5)-L-arabinanase

SCOPe Domain Sequences for d6a8ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a8ia1 b.67.2.1 (A:2-313) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
rvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtldp
rdpdyewkdmgpvihstasdnynainpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
pyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqir
plywddegwpyl

SCOPe Domain Coordinates for d6a8ia1:

Click to download the PDB-style file with coordinates for d6a8ia1.
(The format of our PDB-style files is described here.)

Timeline for d6a8ia1:

  • d6a8ia1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6a8ia2