Lineage for d6dhba_ (6dhb A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1148 PDB entries)
  8. 3061263Domain d6dhba_: 6dhb A: [361325]
    automated match to d5f71a_
    complexed with bez, ca, edo

Details for d6dhba_

PDB Entry: 6dhb (more details), 1.7 Å

PDB Description: crystal structure of the human tim-3 with bound calcium
PDB Compounds: (A:) Hepatitis A virus cellular receptor 2

SCOPe Domain Sequences for d6dhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dhba_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mveyraevgqnaylpcfytpaapgnlvpvcwgkgacpvfecgnvvlrtderdvnywtsry
wlngdfrkgdvsltienvtladsgiyccriqipgimndekfnlklvik

SCOPe Domain Coordinates for d6dhba_:

Click to download the PDB-style file with coordinates for d6dhba_.
(The format of our PDB-style files is described here.)

Timeline for d6dhba_:

  • d6dhba_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13