Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Ruminococcus gnavus [TaxId:33038] [361245] (8 PDB entries) |
Domain d5z18b1: 5z18 B:2-185 [361322] Other proteins in same PDB: d5z18a2, d5z18a3, d5z18b2, d5z18b3, d5z18c2, d5z18c3, d5z18d2, d5z18d3, d5z18e2, d5z18e3, d5z18f2, d5z18f3 automated match to d5c70a1 |
PDB Entry: 5z18 (more details), 2.5 Å
SCOPe Domain Sequences for d5z18b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z18b1 b.18.1.0 (B:2-185) automated matches {Ruminococcus gnavus [TaxId: 33038]} leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi alpe
Timeline for d5z18b1: