Lineage for d5yxuf2 (5yxu F:115-192)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (861 PDB entries)
  8. 3061239Domain d5yxuf2: 5yxu F:115-192 [361301]
    Other proteins in same PDB: d5yxua1, d5yxub1, d5yxuc1, d5yxuc2, d5yxue1, d5yxue2, d5yxue3, d5yxuf1, d5yxug1
    automated match to d4mayc2

Details for d5yxuf2

PDB Entry: 5yxu (more details), 2.7 Å

PDB Description: an affinity enhanced t cell receptor in complex with hla-a0201 restricted hcv ns3 peptide klvalginav
PDB Compounds: (F:) T cell receptor alpha chain

SCOPe Domain Sequences for d5yxuf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxuf2 b.1.1.2 (F:115-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnn

SCOPe Domain Coordinates for d5yxuf2:

Click to download the PDB-style file with coordinates for d5yxuf2.
(The format of our PDB-style files is described here.)

Timeline for d5yxuf2:

  • d5yxuf2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13