Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species [ruminococcus] gnavus [TaxId:33038] [361227] (3 PDB entries) |
Domain d5z19a3: 5z19 A:279-597 [361299] Other proteins in same PDB: d5z19a1, d5z19a2, d5z19b1, d5z19b2, d5z19c1, d5z19c2, d5z19d1, d5z19d2, d5z19e1, d5z19e2, d5z19f1, d5z19f2 automated match to d5c70a3 complexed with sj5 |
PDB Entry: 5z19 (more details), 2.5 Å
SCOPe Domain Sequences for d5z19a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z19a3 c.1.8.0 (A:279-597) automated matches {[ruminococcus] gnavus [TaxId: 33038]} vriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshypy aeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiadte emitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknskpe lckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtdtm aglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhkgv ftrdrqpkaaavvfkdrwe
Timeline for d5z19a3: