Lineage for d6dqyv2 (6dqy V:91-208)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946391Species Hypocrea jecorina [TaxId:431241] [340063] (6 PDB entries)
  8. 2946431Domain d6dqyv2: 6dqy V:91-208 [361294]
    Other proteins in same PDB: d6dqya1, d6dqyb1, d6dqyc1, d6dqyd1, d6dqye1, d6dqyf1, d6dqyg1, d6dqyh1, d6dqyi1, d6dqyj1, d6dqyk1, d6dqyl1, d6dqym1, d6dqyn1, d6dqyo1, d6dqyp1, d6dqyq1, d6dqyr1, d6dqys1, d6dqyt1, d6dqyu1, d6dqyv1, d6dqyw1, d6dqyx1
    automated match to d5tira2
    complexed with mn

Details for d6dqyv2

PDB Entry: 6dqy (more details), 2.3 Å

PDB Description: crystal structure analysis of superoxide dismutase from trichoderma reesei
PDB Compounds: (V:) superoxide dismutase

SCOPe Domain Sequences for d6dqyv2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dqyv2 d.44.1.0 (V:91-208) automated matches {Hypocrea jecorina [TaxId: 431241]}
pdadpasapeltaeiaktwgsldkfkeamgkallgiqgsgwgwlvkegsglrivttkdqd
pvvggevpvfgidmwehayylqylngkaayvdniwkvinwktaeqrfkgdredafkil

SCOPe Domain Coordinates for d6dqyv2:

Click to download the PDB-style file with coordinates for d6dqyv2.
(The format of our PDB-style files is described here.)

Timeline for d6dqyv2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6dqyv1
View in 3D
Domains from other chains:
(mouse over for more information)
d6dqya1, d6dqya2, d6dqyb1, d6dqyb2, d6dqyc1, d6dqyc2, d6dqyd1, d6dqyd2, d6dqye1, d6dqye2, d6dqyf1, d6dqyf2, d6dqyg1, d6dqyg2, d6dqyh1, d6dqyh2, d6dqyi1, d6dqyi2, d6dqyj1, d6dqyj2, d6dqyk1, d6dqyk2, d6dqyl1, d6dqyl2, d6dqym1, d6dqym2, d6dqyn1, d6dqyn2, d6dqyo1, d6dqyo2, d6dqyp1, d6dqyp2, d6dqyq1, d6dqyq2, d6dqyr1, d6dqyr2, d6dqys1, d6dqys2, d6dqyt1, d6dqyt2, d6dqyu1, d6dqyu2, d6dqyw1, d6dqyw2, d6dqyx1, d6dqyx2