Lineage for d5z18d3 (5z18 D:279-603)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (103 species)
    not a true protein
  7. 3061187Species Ruminococcus gnavus [TaxId:33038] [361249] (2 PDB entries)
  8. 3061214Domain d5z18d3: 5z18 D:279-603 [361276]
    Other proteins in same PDB: d5z18a1, d5z18a2, d5z18b1, d5z18b2, d5z18c1, d5z18c2, d5z18d1, d5z18d2, d5z18e1, d5z18e2, d5z18f1, d5z18f2
    automated match to d5c70a3

Details for d5z18d3

PDB Entry: 5z18 (more details), 2.5 Å

PDB Description: the crystal structure of ruminococcus gnavus beta-glucuronidase
PDB Compounds: (D:) beta-glucuronidase

SCOPe Domain Sequences for d5z18d3:

Sequence, based on SEQRES records: (download)

>d5z18d3 c.1.8.0 (D:279-603) automated matches {Ruminococcus gnavus [TaxId: 33038]}
vriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshypy
aeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiadte
emitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknskpe
lckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtdtm
aglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhkgv
ftrdrqpkaaavvfkdrwekknelf

Sequence, based on observed residues (ATOM records): (download)

>d5z18d3 c.1.8.0 (D:279-603) automated matches {Ruminococcus gnavus [TaxId: 33038]}
vriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshypy
aeewyqfadeegfliidevpavgmmrsytyffealtvpellkshiadteemitrdknhps
viawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknskpelckcyplcdfi
clnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtdtmaglhklpsimw
seeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhkgvftrdrqpkaaa
vvfkdrwekknelf

SCOPe Domain Coordinates for d5z18d3:

Click to download the PDB-style file with coordinates for d5z18d3.
(The format of our PDB-style files is described here.)

Timeline for d5z18d3:

  • d5z18d3 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13